DPCstruct | MC37730
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 432 ± 78 aa |
| Standard deviation of domain lengths | 78.26 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 74.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 33.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12070 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8XNG4 | 3-476 | IMAGMAEHERKIVIEFCHLLEKSKQLFNGLRDLPQYGHKQWQAYFGRTFDIYTKLWKFQQQHRQVLDTKYGLKRWQIGEIASKIGHL… |
| A0A6S7I1Z4 | 2-409 | DFVKELIKELRQYIDEYTMVYDPTDEGDWRLVVNEVTAFIDSESLVTVMNADVTPRILSHRLNSERPREENERPSLSLQEIVIVGNS… |
| D3B9Y2 | 60-580 | None |
| A0A2V0PLE0 | 15-681 | None |
| A0A1Y1W115 | 64-492 | None |
| L9JDX3 | 34-493 | None |
| A0A199VMI1 | 113-545 | None |
| A0A6F9A5E8 | 2-362 | None |
| H9GJK1 | 1-371 | None |
| A0A0M0K1X8 | 2-534 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.