DPCstruct | MC37726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 133 ± 14 aa |
| Standard deviation of domain lengths | 14.04 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497AEF6 | 2-133 | FDLTKEVPRLDLCQQLKRLGFPQETGGFYWRKFKDGWKVDYIPYISVVKRMVRQGVIIKAPTSVELDKYLPCFIYKGKDKYFKQYDT… |
| A0A2D3LPJ2 | 17-173 | MAQIATTIEQSKKFKGLGIDVDSADMSWHFTNMRTESLQWELKTVPLVTKENFFGKIEKLASPFYKHADGSPMTGDEVFDKIWGKDL… |
| A0A316NVU4 | 5-113 | None |
| A0A1M3LAH9 | 1-135 | None |
| A0A7J0B2W0 | 2-132 | None |
| A0A1D7Y034 | 33-145 | None |
| A0A497SZB1 | 1-163 | None |
| A0A6M5FGI4 | 1-127 | None |
| A0A7C2A5Z7 | 3-136 | None |
| A0A562SZY6 | 1-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.