DPCstruct | MC37724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 120 ± 8 aa |
| Standard deviation of domain lengths | 8.01 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.17 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0749- CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497A230 | 6-124 | IIVVQFGRKGTLDLAACARIGYLTRYAPGTRENGGVYTHVATWAMLVKCPLRREDAAYRMYRKVCPIYRGLAPERYQARPYITSGNV… |
| A0A1V5L8E0 | 169-298 | DSTHKLLGTEHGIMLQQPAYSRYYLELGEISSYPPGYKENAGIFCHNNPWIMIAETVIGRGDKALEAYLRINPSAREKLAELHRCEP… |
| A0A0S2W3C5 | 12-128 | None |
| A0A3D0DQH2 | 12-111 | None |
| A0A1Y5GM50 | 171-298 | None |
| K1SHX5 | 1-118 | None |
| A0A7V4F1I0 | 14-133 | None |
| I4VUR4 | 133-253 | None |
| A0A380ZIN3 | 16-132 | None |
| A0A2E0WZ60 | 972-1088 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.