DPCstruct | MC37718
Metacluster Properties and Pfam Annotations
| Number of structural domains | 161 |
|---|---|
| Mean domain length (aa) | 166 ± 36 aa |
| Standard deviation of domain lengths | 35.70 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 89.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.53 |
| Pfam Score | 82.86 |
| Assigned Pfam label(s) | CL0264- PF02910- CL0172- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2IQA9 | 250-433 | AGVHGANRLGGNSLIDTQVFGKRSGEHAAKFAKSETFHSIDLKQVEEEQKRILSIAKEKSDKIRPVKIREQLCEVMWENAGIFRDGN… |
| A0A812AC96 | 5-113 | AGGIGWQYTTSEPALLRGLEKLQVLKEDADKLAAETLHELMRAWENYHRLLTAECHMRHLLYRKETRWPGYYYRSDYPDMDEQNWRK… |
| A0A845S5A0 | 2-93 | None |
| T2SZI6 | 17-212 | None |
| A0A1A2BHG3 | 2-118 | None |
| A0A821W5I3 | 3-183 | None |
| A0A6V8DTQ5 | 22-176 | None |
| C4JLX3 | 374-559 | None |
| A0A7C1UZV3 | 19-198 | None |
| A0A7V0W0Q4 | 104-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.