DPCstruct | MC37717
Metacluster Properties and Pfam Annotations
| Number of structural domains | 110 |
|---|---|
| Mean domain length (aa) | 254 ± 47 aa |
| Standard deviation of domain lengths | 46.77 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.05 |
| Pfam Score | 54.53 |
| Assigned Pfam label(s) | PF15412- CL0157- CL0257- PF08743- CL0459 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K0V391 | 2-157 | LLSRLLACKTFKDVASMIEGRLAAGAKSVARSAGPEEPFRSLAPDPLLSTTLAQFRAAALRAFAPKEEIEQVVDLFHVQPLRTSVRE… |
| A0A7C7UBY5 | 7-256 | LREARDRALRIVHLCREVETKGFNPFEVDVKEELEALRSLLPAWVKPSDLTLDGEALRSLSRVVGLQDEWVRARSKLRILDPETVRA… |
| A0A7C7M0G9 | 1-287 | None |
| B4DWS2 | 1-172 | None |
| A0A4Y7L166 | 5-227 | None |
| A0A7W1YV36 | 9-241 | None |
| A0A1F6RIK8 | 4-272 | None |
| A0A068UNX3 | 67-370 | None |
| A0A835HAX9 | 5-256 | None |
| A0A818Y4S0 | 15-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.