DPCstruct | MC37712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 68 ± 6 aa |
| Standard deviation of domain lengths | 6.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 56.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7U895 | 1-69 | METTRLYRPVGLKEMELIAETDYKLFPPRLDWQPIFYPVTNQEYAEQIAFEWNTVDEFSGFIGVVTAFE |
| A0A847QSB7 | 2-73 | KLYRPVGLKELKKIIELGFRGFPPRLPQQPIFYPVLNQGYAEEIASQWNTNDHFSGFVGYVLELEPSLKKEL |
| A0A3R6SM06 | 1-66 | None |
| A7BZK5 | 2-61 | None |
| A0A544XAY4 | 1-59 | None |
| A0A4R2RN03 | 134-200 | None |
| E3FKS1 | 1-66 | None |
| S9PE11 | 11-85 | None |
| B2IYH6 | 235-306 | None |
| L7FB06 | 94-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.