DPCstruct | MC3771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 239 ± 56 aa |
| Standard deviation of domain lengths | 56.15 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 84.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1LB91 | 2-231 | QTECLLESTEETTLDIKVRFLHLVSREIGKLETPLIDLPTDVEPDFQLVQTLEAGGQLFQTWQEAVEREVNLPTFSFSDISHIRQQD… |
| A0A3M2LUF0 | 2-224 | SDVELARDLADSLLLAAGRPRRALAPPGPGAASRVRADCALRAEPDALVRMRLRFLHFQARRVEPDGVADCHGIALHPGDEAVAEEI… |
| A0A3N4STQ6 | 9-301 | None |
| A0A1M6FPG0 | 92-308 | None |
| A0A5D0P8Q8 | 3-205 | None |
| A0A344UU85 | 42-233 | None |
| A0A5P8WGC9 | 131-328 | None |
| A0A439S4R6 | 84-266 | None |
| A0A178K3B5 | 6-265 | None |
| A0A069K4B0 | 4-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.