DPCstruct | MC37706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 176 ± 17 aa |
| Standard deviation of domain lengths | 16.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 68.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 32.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I6SKP9 | 225-389 | LRFRTIASPQAFELAGLLAAVPLNTPIMREVQRVMLPDSDLSVLAEVLLSGLLQRTSNDPSERDPAVPTHEFGDGVRAELLATGYRS… |
| A0A7K2MYI9 | 1-201 | MTQPRVPAPRQEACAEPTAEQRVVEFLEKALGDTCELTVLLAAAPLNRHIMQLIAYHLMPQTGPEHLAEILSSGLLQVVDANDPRST… |
| A0A2S3XTV9 | 195-380 | None |
| A0A6B2T0F4 | 8-167 | None |
| A0A367F2X8 | 160-315 | None |
| A0A6N2IFG5 | 379-548 | None |
| A0A4D4L4H0 | 143-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.