DPCstruct | MC37704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 201 ± 32 aa |
| Standard deviation of domain lengths | 32.11 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 15.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16162 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7YV74 | 101-278 | HFELTGGEIPAPKLFDDLRDLLNQPRLTKNLLTKPRLYAVAVQTSKGIALFGRRMAYLKVLGRQRSIFAAVWDGDTFNKLDKSVATF… |
| A0A450X471 | 15-197 | LGIPVAETDLQSIIDTLQDSEEPKTIGRYEELLKASMYIARFDIEGQPPLLSARRVSDSWTTKKVLTLISMIFRDNMLMDLDQQQIF… |
| A0A7X2D6U6 | 2-182 | None |
| A0A645FPG7 | 1-228 | None |
| A0A2U1S6U7 | 64-307 | None |
| A0A2P1MMU9 | 109-364 | None |
| A0A0E3SL71 | 2-154 | None |
| A0A519RSD2 | 42-231 | None |
| F5TC77 | 1-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.