DPCstruct | MC37701
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 168 ± 30 aa |
| Standard deviation of domain lengths | 29.75 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03849 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183JAM2 | 2-163 | QSVLRYLALPSEDTERTVSVETKTVLQEAGLLHKSADGLAITSYGFQFLLMDYAKQIWSYLVHYLEYMEKKSSSPEEAISFLLASVF… |
| A0A4Y9YT09 | 111-232 | ETILHYMVSSGTGQHPTKPSQEVLFLLQRSGLMTRVHGGVLQITSSGFQFLLHDPHAQLWELLLQFLHMAEERQMDLVEVLSFLLML… |
| A0A453DGS4 | 26-148 | None |
| A0A812SJ75 | 11-225 | None |
| A0A158PE22 | 516-646 | None |
| A0A812SRZ0 | 449-663 | None |
| A0A0F7SUA4 | 475-676 | None |
| A0A2K2DM19 | 47-209 | None |
| A0A453DGT1 | 28-191 | None |
| A0A0D8XTJ2 | 9-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.