DPCstruct | MC3770
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 66 ± 7 aa |
| Standard deviation of domain lengths | 6.92 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 54.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13099 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438ZQ25 | 4-65 | IAWYTNSDLAFLKRLSSNDLKDLFDALVYDKDSEKRFTEGLTLSEEYKRHGNDYAKYPERIA |
| A0A8A8J5K6 | 1-55 | MEFLKRLSSNDLKDLFDALVYDEDGTLRMNEELTSSTEYQRCGHDYAKYPMRIAE |
| A0A438V025 | 1-71 | None |
| M3JXJ3 | 10-71 | None |
| E1S760 | 1-62 | None |
| A0A4U8S7W3 | 70-144 | None |
| A0A6M8SXC4 | 1-70 | None |
| A0A7G9GZF0 | 1-71 | None |
| A0A2A6YYN9 | 2-54 | None |
| A0A2D3PPF9 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.