DPCstruct | MC377
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 162 ± 18 aa |
| Standard deviation of domain lengths | 18.37 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0352 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I7LBP8 | 2-138 | LSAGPGPGPLHEAATAWTALCAEHTSAAEELTTLLGGVQAAAWQGTSAQSYVDAHAPYLAWLTTTSADYAATPAEHEVAAGAYTSAL… |
| A0A7W5STI7 | 113-271 | FDFTSVSPEVNSNRVYSGAGSSSLLSAAAAWNGLADELNAAAQGVDRVLKAFGSTPGAGPAAHAMATATSPYVGWLSAAAAQAENAA… |
| A0A655F9U4 | 2-112 | None |
| A0A653ER01 | 5-163 | None |
| A0A7I7Z4D8 | 3-175 | None |
| A0A1X1YYE1 | 89-260 | None |
| A0A7I7PDL8 | 9-179 | None |
| W9B6R6 | 1-162 | None |
| A0A7W7FWS4 | 15-188 | None |
| A0A7Z7ND45 | 3-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.