DPCstruct | MC37699
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 141 ± 28 aa |
| Standard deviation of domain lengths | 27.78 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.11 |
| Pfam Score | 65.71 |
| Assigned Pfam label(s) | PF09172- CL0020- PF19444 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9DS67 | 31-154 | CPCGSLANALKDLLEAEQINQVGSFIVSHLRNLRATSNPEKQQAKEQLKEVRTTKRFPEDFRKFSHNIEFSYLLDGINVGTTTESNV… |
| A0A183JAJ5 | 10-136 | MKCPSRPLVEKVKSVFEKEQINQVRSFVSAFIDEIRTSNDPEKANLRQIIKSQFFDPKAQKDPRRFSSYVEHGSFSQETNYGILADQ… |
| A0A6P4Y4C5 | 168-297 | None |
| A0A8B6HK88 | 466-580 | None |
| A0A7R9JMN0 | 1-108 | None |
| A0A7J6AL92 | 282-461 | None |
| A0A6H5HF95 | 634-784 | None |
| A0A444SM94 | 108-228 | None |
| A0A1D2N752 | 202-352 | None |
| A0A182TTA8 | 3-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.