DPCstruct | MC37697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 393 ± 31 aa |
| Standard deviation of domain lengths | 31.01 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15917 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4WCJ0 | 454-841 | FLVFQLRIFHSWFFQHCMVEYRSEIILANRGAVLKNQLIEKEMKEQNEQQKAKFDEIRQRTEVIRERYKKQMEKGDIICEPQTYAHA… |
| A0A183J8J1 | 1-374 | MKTQQEKEKRLVEKIKKSAEMIRNRYLKSVEGKAVFEPTTYGQAKRAGDYYMFEYDLDADVVDTTQQEEDQFEDVSEGSVEKLGPAQ… |
| A0A4Y2IWL4 | 10-391 | None |
| A0A820YIR4 | 224-649 | None |
| A0A0N5B170 | 758-1123 | None |
| A0A5S6P970 | 624-968 | None |
| A7RMM3 | 2-359 | None |
| A0A653DHE2 | 293-712 | None |
| A0A182EAX7 | 178-545 | None |
| A0A077Z8J1 | 704-1114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.