DPCstruct | MC37694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 133 |
|---|---|
| Mean domain length (aa) | 186 ± 35 aa |
| Standard deviation of domain lengths | 34.67 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.70 |
| Pfam Score | 85.34 |
| Assigned Pfam label(s) | CL0123- PF08033- PF04810- CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183J790 | 11-183 | EEIDGVRFDWNVWPHSRIEAQRLVVPIGCLFTPLKERPQDAAQPPPLNYDPVLCSRPTCKAVLNPYAQVDYRNKQWVCPLCFQRNPF… |
| A0A2G9RY05 | 2-148 | AKQSQVPLAAVIKPLATLPSDEALPCVVDHGETGPIRCNRCKAYMCPSMQFIEGGRRFQCCFCSCVTEVPPHYFQHLDHTGKRVDCY… |
| A0A0D2NIF7 | 172-389 | None |
| A0A0V0R1R4 | 115-344 | None |
| A0A7J0FVK2 | 3-201 | None |
| A0A5B7DRB5 | 603-746 | None |
| A0A7R9PUE4 | 425-630 | None |
| A0A7J9KRU9 | 3-194 | None |
| A0A7R9A1X6 | 243-406 | None |
| A0A6V7PFP6 | 87-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.