DPCstruct | MC37690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 152 ± 12 aa |
| Standard deviation of domain lengths | 11.92 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 71.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 18.55 |
| Pfam Score | 52.38 |
| Assigned Pfam label(s) | CL0500- PF19850 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A852ZN86 | 33-181 | GPLGPVDVMALAFPGTVLDPALAEHFGRVLLHGAVEPLDAVVVRREPDGRVTTGELEGEPGFQHLAEELHGGGTVGLLTGEHLVAVG… |
| A0A2T7TSW9 | 2-165 | AELVAIAFEGPHEADRVLTELGRLQKEHLIDLEDAVVAIRQPDGRVHLKQSVNFVGEAAVSVGLSGAFWGTLVGLLFLNPLAGFAVG… |
| A0A418WUX4 | 30-179 | None |
| A0A4R8DH03 | 1-173 | None |
| A0A1V4A7I3 | 5-165 | None |
| A0A6P2BL20 | 1-135 | None |
| A0A6P2BSY3 | 2-142 | None |
| A0A2U3K375 | 137-284 | None |
| A0A0Q8YFP1 | 3-166 | None |
| A0A534UNX9 | 1-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.