DPCstruct | MC37681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1311 |
|---|---|
| Mean domain length (aa) | 186 ± 36 aa |
| Standard deviation of domain lengths | 36.42 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 13.24 |
| Pfam Score | 89.71 |
| Assigned Pfam label(s) | CL0023- PF19737- CL0063- CL0578- CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381YPJ2 | 32-180 | FKTPEEEMNVRMNNLKDIIKIFNEENILYWLQGKTLLGLYKNKRLIENDHDEDIGTDIKNLDIVARKIIPKLESIGFVVIRCPKDNS… |
| A0A0G0PPG1 | 8-184 | LEKINRGILIGLRDLSEFDKATFWVMGSVVCTALNGEYFRRIGDIDILIYEKDYEGLREFLISKGYEIKIGRPWNLSSLSGFHWIEA… |
| A0A7R9L7S1 | 163-331 | None |
| A0A852V183 | 2-144 | None |
| A0A538QN95 | 1-150 | None |
| A0A1L9TL33 | 6-153 | None |
| A0A5C7XIQ1 | 114-352 | None |
| H0EGY3 | 4-170 | None |
| J4KTC6 | 36-216 | None |
| A0A5C7YU64 | 94-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.