DPCstruct | MC3768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 115 ± 15 aa |
| Standard deviation of domain lengths | 15.33 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E1VP18 | 59-172 | KLVRYVSKDGMAHAVYLASFTPGHEDKATHVLVGLGKWGEDAPPSERTAFAVKIWDNDDQWAVSVLDKDDSPWGSVEFLGKVLDRDE… |
| A0A1F9KIG2 | 16-121 | VHRENQTEAAYFVHWSLGKVAEKGAHIDLILGPWGEGTERADRYAVSLEFRQGFGVRIIDASIRNIARHSLVGRGLPREDVIMTPLA… |
| A0A2A4ZCD8 | 2-93 | None |
| A0A699GFB8 | 1153-1262 | None |
| A0A0F5PW86 | 2-113 | None |
| A0A3B1B7H7 | 12-134 | None |
| A0A7Y4ZKY0 | 12-133 | None |
| A0A6G6Y8H2 | 3-96 | None |
| A0A323UC43 | 37-150 | None |
| A0A3B7M5J1 | 1-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.