DPCstruct | MC37677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 51 ± 4 aa |
| Standard deviation of domain lengths | 4.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 66.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834PBC4 | 1-47 | MYSDGHEVDGSWVLRVYVTDLQVERSLRVKGELHIGGVMLRLVEDLG |
| A0A6L5CS56 | 1-54 | MMSDGQIVGDGSWNLRVFVTDLNMERTLRVKGDLHIGGVMLRLVEELGKLFAES |
| A0A834U2T9 | 2-48 | None |
| G3V379 | 8-52 | None |
| A0A194RL45 | 1-54 | None |
| A0A1D2NA79 | 1-50 | None |
| A0A3L8S8V2 | 33-78 | None |
| A0A5B7IE03 | 1-49 | None |
| A0A5E4Q182 | 1-48 | None |
| A0A6A0H6N3 | 18-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.