DPCstruct | MC37675
Metacluster Properties and Pfam Annotations
| Number of structural domains | 743 |
|---|---|
| Mean domain length (aa) | 229 ± 51 aa |
| Standard deviation of domain lengths | 51.24 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 14.30 |
| Pfam Score | 91.20 |
| Assigned Pfam label(s) | CL0459- PF11411- PF10283- CL0219- PF03167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A146HHB5 | 11-192 | LAFKFFIQKDLPETLQAELCETIASLGGRVEIKVPRAGFILINPNTPEEERLRLCWMSPDRPERYFVPYTFVDACKVANMLLKQIFL… |
| A0A6L5CQB4 | 41-267 | KLGQEENLESSCLLETMNDSGATYNSSTLAFSEPKCNKKLSITKGNLVLTSLSQEEMTFVEEVTNKLGSYAIVNEVDATVTHIVCGL… |
| A0A2W1BR07 | 3-237 | None |
| A0A1Z5ST25 | 10-301 | None |
| A0A2W1BSD6 | 322-544 | None |
| W6Y0J9 | 2-226 | None |
| A0A7S2UTY0 | 37-190 | None |
| B5VL86 | 4-220 | None |
| A0A0S4KQZ9 | 741-1067 | None |
| R1CRK5 | 135-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.