DPCstruct | MC37674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 150 ± 25 aa |
| Standard deviation of domain lengths | 24.76 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 69.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 21.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L5CL01 | 2-144 | ALLEDVKSIIKSILISTQKQMLVFDLAREYMASEGRCIPFQSLGYRTLPDFLKSIPDTMQLRTGQYNGRTLYFVQPVVNEATQHIEA… |
| T2M8U5 | 6-102 | EEVKKIVRSLLLSAKQGLTINQLCSEYTDLEHKTLPYKEFGYNSAISFMKSMPDVVRPVFLSRGDMVLQGVADESTAHIKELVQRQR… |
| A0A182JN69 | 151-282 | None |
| A0A817RIU3 | 262-421 | None |
| A0A482WGR6 | 1-157 | None |
| A0A4U5LXV1 | 40-205 | None |
| A0A6V7V6U3 | 1-227 | None |
| A0A182Q261 | 30-114 | None |
| A0A816T2Y0 | 8-178 | None |
| A0A816MMG6 | 7-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.