DPCstruct | MC37673
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Standard deviation of domain lengths | 5.52 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 43.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4CEJ7 | 1-71 | MAGAEWESLEQCLEKHLPSQDLREVKRVLYGKETRKLDLPSRAFEVASEGNFELQGYAFEAAKEQLRRPQI |
| A0A368FU61 | 1-68 | MAAPVEFEGVETSLQARLQGKEYDEVRRILYGRAYPELQISSDARQMAEKGGYEINGYEISAQPEQLR |
| A0A2K5QB88 | 3-70 | None |
| A0A0N4XZ12 | 2-79 | None |
| A0A1B0C9G1 | 1-71 | None |
| A0A401Q3I7 | 3-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.