DPCstruct | MC37671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 126 |
|---|---|
| Mean domain length (aa) | 153 ± 30 aa |
| Standard deviation of domain lengths | 30.11 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L5CE43 | 4-132 | KYPAVLTDSLQEQDMMVPLFSGYGTMIDRNQINRCIINCKGDPAKLQRLLLIAVKGKAYIAQHSAGGQRARGNDDQPPKGHPAADED… |
| A0A6J1N3H5 | 827-958 | PPEYNPENSRWTLKYQNSSAGVVEIMPHSSVYVDEKKFIICKLKAKDCKSLARMLLIEIFSDNALRVCSLTGARSNAHKPPQVRPGL… |
| A0A1S3QV86 | 1-148 | None |
| T1GVD2 | 1-128 | None |
| A0A5A9NBU0 | 97-274 | None |
| A0A7M7GQK2 | 384-520 | None |
| A0A6P8VQQ5 | 11-212 | None |
| A0A5K4FC92 | 196-402 | None |
| A0A226EUW0 | 207-345 | None |
| A0A821U093 | 49-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.