DPCstruct | MC37670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 158 ± 15 aa |
| Standard deviation of domain lengths | 14.60 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M7M1J5 | 101-266 | DYIKRTFNTDYADLHLTWKDNHYDWLPGPKQIPKQLGQQLDKEFLDKLEVRMLDTALLDAYEYMQRYAVGLEQIAWDQEDHGLEFRK… |
| A0A6L5C9I0 | 32-189 | EEVKSTFDVDFDQHHQSWKSLHYDWLPIFPKSLGERTPDEHLQQLELEQALKDSYSSLQKIAVGLEQVAWDQEDSSGFKSDFRATEY… |
| A0A5N5TCC4 | 281-449 | None |
| A0A7R9DHB3 | 1-144 | None |
| B7PIU5 | 122-269 | None |
| T1KLS3 | 145-285 | None |
| T1KLF4 | 2-143 | None |
| C3YIH4 | 783-973 | None |
| E2AB84 | 74-234 | None |
| A0A7R8ZVA1 | 3-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.