DPCstruct | MC37668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 134 |
|---|---|
| Mean domain length (aa) | 175 ± 33 aa |
| Standard deviation of domain lengths | 33.02 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 38.48 |
| Pfam Score | 99.21 |
| Assigned Pfam label(s) | PF00925- PF00926 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L5C5U8 | 11-201 | AIKDIRKGKCIILVDDEDRENEGDLVIAADKVTPQAINFMAKHARGLICLALTPERCEELQLPPQAIENTATFGTAFTVSVDARKGI… |
| A0A080KN16 | 2-153 | ALTIRYGSGIVCLCMPQSFCDKLELPMMVTNNTSKNHTAFTITIEAAKGVTTGVSAADRVTTVKAAVADNAKPSDLNHPGHVFPLVA… |
| G4MAL5 | 5-161 | None |
| A0A6L5EYZ1 | 55-161 | None |
| A0A1V2LQW4 | 640-827 | None |
| A0A1Q9C9X7 | 740-867 | None |
| A0A6A7G9R6 | 127-320 | None |
| A0A177WMA1 | 288-493 | None |
| A0A7C7XCG8 | 15-197 | None |
| A0A2T6ZSL8 | 10-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.