DPCstruct | MC37664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 4.65 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 49.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0EIF5 | 1-75 | MNATKWPSLTEFAKFLGREGICRVEEEERGLFVSWIDNSPEALRRQDAIRKKERQDKGDEEREQMLIRQQVARAK |
| A0A044V6U4 | 1-76 | MNLTEWHTLTDFVVYFGKSGKCYIDQTEKGWFIAWINQEELRKQKALHNVRSIHNDEERLQQLLWEQQKELAKNNN |
| A0A498KR47 | 107-182 | None |
| A0A433DFT7 | 122-208 | None |
| A0A2G9URU1 | 39-116 | None |
| A0A1Y1XWD6 | 107-180 | None |
| A0A421G9P3 | 54-135 | None |
| A0A5N5QVP2 | 107-182 | None |
| A0A4D9BMH6 | 1-80 | None |
| A0A6V7NF26 | 310-385 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.