DPCstruct | MC37662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 126 ± 7 aa |
| Standard deviation of domain lengths | 6.94 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 71.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 37.46 |
| Pfam Score | 87.27 |
| Assigned Pfam label(s) | CL0123- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9CFA4 | 1-132 | MLYAEEIQWGIIKVGHWNPLPIHFLTDAPEATVSDMLLDVYHMVTLHIQLQSFAKLEDLPSEQWNHATVRNALKELLKEMNQSTLAK… |
| A0A044SNG8 | 1-135 | MIKKRSLVQVANWKALPFDQITDNLDDTVESLLKDISNHITLKILTKQSSTDASSSQCISDLRQRLLKAAISKQPHILSTVDNQQIK… |
| A0A3Q3A207 | 58-180 | None |
| A0A671TYH9 | 43-171 | None |
| A0A7E4VXT0 | 65-196 | None |
| A0A6L5CRB5 | 72-195 | None |
| A0A3P6QS43 | 135-260 | None |
| G1NEL9 | 23-131 | None |
| A0A1S0UK78 | 61-184 | None |
| A8X5Y9 | 59-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.