DPCstruct | MC3766
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 166 ± 16 aa |
| Standard deviation of domain lengths | 16.15 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 94.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A518I144 | 52-220 | TELVHSAGMPRQEIEEPGISPRELVGRMVHGLGNITNTANYHWLLQICREFFDFTDDAITPDNWESLFDTAEEKMNGAGWAQTVLDK… |
| W4TNN6 | 7-153 | VTERPSPENADRIYDTIAEQIAQPDFRPRALMNSFDIAFIATTDDPCDDLDGHARLAADETFTRRVAPTFRPDKYLEPAAGGWTGLL… |
| W4VHE3 | 9-199 | None |
| A0A2Z5Z6T8 | 12-164 | None |
| W4U5W5 | 55-216 | None |
| U2YPV8 | 1-144 | None |
| A0A1C6ASU6 | 20-191 | None |
| A0A484ZM02 | 8-168 | None |
| A0A0B8Q9X8 | 64-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.