DPCstruct | MC37656
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 252 ± 57 aa |
| Standard deviation of domain lengths | 56.79 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 73.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 38.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P1RV61 | 6-253 | LVLLRLAYQSLGVVYGDLGTSPLYVFYNTFPHGVKDRQDVIGALSLIIYSLTLVPLLKYVFVVLRANDNGQGGTFALYSLLCRHAKI… |
| A0A831DJG8 | 12-227 | LTLAAIGVVYGDIGTSPLYTLRECLSGQFGFGVERDAVFGFLSLIFWLLIFTVSIKYITFVMRADNAGEGGILTLMSLAGRNTSARM… |
| R1GJ11 | 15-252 | None |
| A0A287IDX1 | 1-229 | None |
| A0A2P2MWA1 | 13-180 | None |
| A0A0W0WIN9 | 2-139 | None |
| A0A835JLN6 | 28-314 | None |
| A0A151TND8 | 303-624 | None |
| A0A540KRR2 | 3-327 | None |
| A2YBJ9 | 11-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.