DPCstruct | MC37649
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 174 ± 24 aa |
| Standard deviation of domain lengths | 23.51 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08620 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M3CYW8 | 1-174 | MQSASAKNTYDPSAAALNAGDVRFSFRGDLIPPSKANEIPVTLGLHHHGDAPEAAGYTIAELAHLARSSYAAQRCIAFQTLGRILYK… |
| A0A6A7BTH0 | 207-366 | LPAEPDKLEWMQITSTGPDAYDPSAECLRAQDIRFGFDGGIIGPRTAAVIPVTEGLHHHGDSPNSAGYTIAELALLSRSAYAPQRCL… |
| B8MNH4 | 252-451 | None |
| A0A1J7IGV2 | 166-344 | None |
| Q6C4H3 | 293-490 | None |
| A0A4U0V6T2 | 261-422 | None |
| A0A317V2C2 | 23-237 | None |
| I7IHH9 | 103-268 | None |
| A0A5M9JBB1 | 1-114 | None |
| A0A3M2SV00 | 23-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.