DPCstruct | MC3764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 101 ± 14 aa |
| Standard deviation of domain lengths | 13.89 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 43.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A348XGY4 | 254-355 | CHNGEINTLRGNINWMNARQGLFTSELFGDDMRKLMPICTPGASDSATLDNAVELLLHTGRPLAHVMSMLIPEAWQNHETMSDQKRA… |
| W4TEP0 | 186-295 | LAHPYRLIAHNGEINTVRGNRSWMQAREALLQSDLIPGDLARLYPICTPSGSDSASFDEVLELLHLGGRSLPHTVLMMIPEAWQENT… |
| A0A397EI07 | 2-80 | None |
| A0A0F2SKJ9 | 2-100 | None |
| A0A212DLH0 | 16-118 | None |
| A0A182TIG5 | 182-267 | None |
| A0A1Z1XBB0 | 245-369 | None |
| A0A0Q9XCL6 | 306-411 | None |
| A0A7J6Q1R0 | 27-144 | None |
| A0A5E4PR16 | 215-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.