DPCstruct | MC37639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 230 ± 61 aa |
| Standard deviation of domain lengths | 60.70 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 82.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.79 |
| Pfam Score | 98.48 |
| Assigned Pfam label(s) | PF07842- CL0449 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C5YTE8 | 6-243 | WLPQVLAAVRRWDALQPGPMLGVMESWDELLPPFVRAQVVGQVVRKLEAAVADWNPRKKRQSQQPPHSWLFPWLPFLPAHQLDAKGT… |
| A0A218XAR9 | 17-239 | TISQWKPLLVQGREELGGVQDTLETAYTAFITPAVRMSGINTWEPWIYEPMLGFLEMWETLLPSVVLQSIVDAIIIPKWSSAVESWD… |
| Q7XPY9 | 61-322 | None |
| A0A0D9UZM1 | 740-993 | None |
| A0A7S0LXS6 | 3-235 | None |
| A0A1A9X779 | 20-177 | None |
| A0A1J3JZJ3 | 143-393 | None |
| A0A1Y1LAF4 | 50-334 | None |
| A0A2P5C3G2 | 34-266 | None |
| D8LY96 | 141-495 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.