DPCstruct | MC37637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 62 ± 4 aa |
| Standard deviation of domain lengths | 4.20 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 67.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7FRM5 | 20-78 | ECRFYEAQYPEIEEVVMVNVRNIAEMGAYVVLLEYNDIEGMILLSELSRRRIRSINKLI |
| A0A218WLR8 | 1-62 | MASHSSNLECRMYEAKYPEVDMAVKIQVKNIADMGAYISLLEYNNIEGMMLFIMNLNQYKLI |
| A0A4D6N0B5 | 357-417 | None |
| A0A7J0HFD4 | 1-60 | None |
| A0A834T7I0 | 4-64 | None |
| M4DKI8 | 85-153 | None |
| A0A0C9LVF2 | 8-64 | None |
| A0A540N7H3 | 110-175 | None |
| A0A5M9K2B7 | 1-54 | None |
| A0A699ZJB6 | 1-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.