DPCstruct | MC37632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 96 ± 6 aa |
| Standard deviation of domain lengths | 5.76 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.94 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 50.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05764 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1ZFA4 | 3-88 | QRERRSNAGNRMAKLLDEEEEDDFYKTTYGGFQDVEEDNDYVEEKEVDDVVDSDFDIDENDEPVSDQDDEEKKKRKVGTKAYKVKL |
| A0A1Y1KHK3 | 1-98 | MRDRAKRSTAGNRMAKLLNEEEECQDEFYKVNYGGFQETATDNEYEAEEEGEDQVDSDFSIDENDEPVSENEEESQRKKRRLVTKAY… |
| A0A4S2L0E1 | 3-101 | None |
| A0A3P7N575 | 1-105 | None |
| A0A3B1JF29 | 1-97 | None |
| A0A2T7PSV0 | 1-88 | None |
| L9LBX4 | 40-132 | None |
| A0A7M7KC94 | 22-124 | None |
| A0A433TAW8 | 1-92 | None |
| A0A7R8V0C8 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.