DPCstruct | MC37626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 180 ± 28 aa |
| Standard deviation of domain lengths | 28.46 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 14.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5PIW2 | 104-269 | PFAVLDVRPQLFKLFFKSYTYDAEKGKGYNFQVNLQFRPRTFFVPEVGDAIKDAYEDTGYKVVGYTRKTREEYSEKTLSTNIVDESE… |
| A0A2V6EGR2 | 1-220 | MPATLKTTEVHPPVPNKWLEQFDLPVADADVLTQDPDGDAFTNLDEWQGHTNPIDKNSHPDYLSKLKLKSFSEEPFRLMFSSWVGDT… |
| A0A2E6TEB5 | 303-477 | None |
| A0A424HK78 | 31-190 | None |
| A0A1V6E460 | 3-143 | None |
| A0A1G0ZQL2 | 27-182 | None |
| A0A1Z8RBF3 | 238-428 | None |
| A0A3B8Q5S2 | 66-227 | None |
| A0A0R2RGR4 | 3-218 | None |
| A0A257LXR5 | 212-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.