DPCstruct | MC3762
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 139 ± 16 aa |
| Standard deviation of domain lengths | 16.13 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U3MMS3 | 20-159 | RDHGTEPLQVTDARAFASACYEAARLVRGKVLEITPPVVTPNFHTAVMKCGESTVGVLGRVHLPVVAIAEVPTGDVVFVDSPHGLEK… |
| A0A1H9S051 | 3-133 | QAVPAGVGEFRGLVHEAARRAGGEVTRWCEPEVTPNFYAAHVEYGDHRPGVAVLRSHAGDVALAVGHDRQPLVFADDAALLSVLSEL… |
| A0A223KN15 | 103-234 | None |
| A0A416REM2 | 2-119 | None |
| A0A2Z6GAL4 | 144-276 | None |
| A0A108UCU7 | 1-161 | None |
| A0A100HJ77 | 2-151 | None |
| A0A1G5J9C0 | 25-175 | None |
| C9ZGB0 | 84-249 | None |
| A0A221KJS0 | 148-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.