DPCstruct | MC37619
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 94 ± 7 aa |
| Standard deviation of domain lengths | 7.12 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U8WED6 | 1-80 | MSGDRPSRSGIPVLVELRADHAIARPVSLAQALRRFGLDLEQAHGALNDIKARHRVRLELYVCERSGPPDDFQEFGLDVR |
| A0A7T8MC80 | 1-92 | MTTDAGRDGMRDTESAPRTPEIAGDVILRLGGEVPEPVTLIRTLSGWGLGLRAAHETVGRLSPGETVPLGLTGAPARDDQRRILNGP… |
| A0A7X3I964 | 1-92 | None |
| A0A3S2VMF3 | 3-104 | None |
| A0A6A7KW03 | 1-104 | None |
| A0A4Q2U2X3 | 1-96 | None |
| A0A6N1AKX1 | 1-97 | None |
| V7FF06 | 9-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.