DPCstruct | MC37615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 106 ± 19 aa |
| Standard deviation of domain lengths | 18.85 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.62 |
| Pfam Score | 99.12 |
| Assigned Pfam label(s) | CL0229- CL0045 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8Z1F9 | 6-96 | DVMPIATGHEREELEAELEGKDILEINYPVGPFGTKENPAIVKSYYDKRIVGCPGGEEEDEHDVVWFWLKKDEPHECPVCGQYFKLE… |
| A0A423VGE6 | 29-150 | IRHIRTIDDLMGPGAKPGTVPTDLEQATGIERLEILGKMEGVDIFDMRPLDASRKGTMKDPIMVRSAGDEQYAGCTGYPVDSHGVIW… |
| B7G0C7 | 129-255 | None |
| A0A4W4EA70 | 62-171 | None |
| A0A6V7XIU3 | 11-118 | None |
| A0A0V1BNZ9 | 353-442 | None |
| A0A2H9TIC6 | 21-134 | None |
| A0A0E0JL35 | 1-83 | None |
| A0A545VX21 | 565-687 | None |
| A0A5J4YMW7 | 62-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.