DPCstruct | MC37614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 112 ± 15 aa |
| Standard deviation of domain lengths | 14.84 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.47 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | CL0521- CL0051 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J8WD90 | 6-118 | LSFSEREGCRNLLGLLDNDEIMALCDTVTNRLVQPQDRQDAVHAILVYSQSAEELLRRRKVHREVIFKYLATQGIIIPPATEKHNLI… |
| A0A672TAI7 | 5-101 | MSKLSMKEQSGCRKLLRLLPLDDLFALKDTVTNRLIAVESTQEAIEAIISYSQDAEELLKRKKVHRDVIFKYLAKEGVAMPPNSDKQ… |
| A0A7R8D1J2 | 2-116 | None |
| A0A815FXA9 | 1-111 | None |
| A0A6P7U4L9 | 3-121 | None |
| A0A815LE10 | 652-769 | None |
| A0A821TJA3 | 1-82 | None |
| T1FJS2 | 3-103 | None |
| A0A4Y2SZJ7 | 59-160 | None |
| T1GCY3 | 2-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.