DPCstruct | MC37610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 70 ± 8 aa |
| Standard deviation of domain lengths | 8.12 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08984 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5Z1N3 | 1-60 | MTINKDTKIGDLLQECPEKASLLLEAGMHCLGCPASQAETLEEACDVHGIDVEELVKQLN |
| A0A6I1KLF2 | 11-90 | PRLFFLTFDEAKQGSTGMITREMTIGEIVRQYPQTLTVFEKYGLDCFECQIADFEALEHGADVHKVDVNILLEELNRAIA |
| A0A7C1MBI3 | 22-92 | None |
| A0A7C4PLF2 | 47-110 | None |
| A0A7R7E9B0 | 18-94 | None |
| A0A0A8WY78 | 1-63 | None |
| A0A3B9K8G9 | 528-599 | None |
| U2UCD7 | 103-166 | None |
| A0A1G1WR06 | 2-74 | None |
| A0A133Y6C7 | 1-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.