DPCstruct | MC37608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 347 ± 54 aa |
| Standard deviation of domain lengths | 54.30 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 16.07 |
| Pfam Score | 34.19 |
| Assigned Pfam label(s) | CL0023- PF12008- PF12161- PF11867 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I1KH13 | 27-350 | QAIARVNRVGGGKKNGLIIDYNGMLKSLRKALATFAQGDRKRKDEEVLRDDTEALAEYGQSIRGVQDYLAGFGFNLDELIAASGFDK… |
| A0A7C5BGD5 | 9-269 | EAKSKDELKYFHNQLEEFFKKYKIDNWRENFEDGIELLVDEEVRNEFISCVREFQRVIDKVLPDPEASKYLNDLKIVNFIKESARNR… |
| A0A847CBL5 | 45-407 | None |
| A0A177T160 | 1-354 | None |
| A0A644Y690 | 14-321 | None |
| A0A7Y4BH81 | 637-1022 | None |
| A0A5E4KM83 | 1-317 | None |
| A0A0A0M635 | 115-499 | None |
| A0A523YT74 | 4-367 | None |
| A0A413W2X2 | 433-776 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.