DPCstruct | MC37602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 160 ± 10 aa |
| Standard deviation of domain lengths | 9.61 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 42.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W7CDI3 | 1-159 | MPAGTRAGCVWVQRLFLPFLDIETGRRVWQFELSTIDSAFLFAGTLTVATYFDRDTADEVEIRQLATTLYERADWEWACDGGPSLTH… |
| A0A497ID67 | 148-304 | RNKDEVYDRILTTLRFFRDSAEGEHGFFYHFLDMETGKRFRWPDGSLSELSSIDTALFLAGALFAGQYFKGTEVEQLAQELYERVDW… |
| A0A662RU20 | 358-507 | None |
| A0A849QU42 | 78-240 | None |
| A0A1E4ZJA7 | 414-587 | None |
| A0A7Y5NFE8 | 214-379 | None |
| A0A8B3S1X0 | 400-548 | None |
| A0A271J121 | 102-268 | None |
| A0A520JV11 | 476-617 | None |
| A0A430SGM6 | 627-787 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.