DPCstruct | MC37600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 283 ± 44 aa |
| Standard deviation of domain lengths | 44.07 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 92.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K7ZUR9 | 75-314 | GVADAMMEDYGMRQKQVQMVARAHKKRREIWEKFNITPRGIDRETSEMMHRTHMGVDNNWQTLLLQGLRNALSDGWGGSMIATEVSD… |
| A0A354KRD1 | 50-378 | CAMGPCRISAKTPRGLCGADEHTIVGRNFARMCAGGTAAHSDHARDIAHTMALTSRDGNYKIREEEKLIALANEWGVETENRDIYHI… |
| A0A378AFT3 | 109-393 | None |
| A0A2J8ABA3 | 134-386 | None |
| A0A1V1V523 | 28-271 | None |
| A0A0V0QJA2 | 255-535 | None |
| A0A7J0BM82 | 18-321 | None |
| T0CXD4 | 8-279 | None |
| A0A497FDU1 | 73-357 | None |
| A0A0F9RDZ9 | 3-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.