DPCstruct | MC376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 124 ± 16 aa |
| Standard deviation of domain lengths | 15.61 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9Q6D6 | 31-154 | PKSAAHSLSRLCSREGLPNVDGSWRPTKYDIELLESRLADISRLRSKGALKSIQISQPGRYYRQYIAVVVGGHRLIYVNAFSHRPTS… |
| A0A523U6A5 | 252-380 | IKTDKSEGVIFPKSAAESLVAGQLKSVKKSWTPKEKDIKKLEAKLEQYLMGNPPEKAPKLHEKLSEYKRQYTGITVEKKKRIYVNLF… |
| A0A7Y8THX8 | 27-158 | None |
| A0A501Q2D3 | 125-249 | None |
| A0A1V5H5V4 | 206-333 | None |
| A0A7T7ZXR7 | 3-143 | None |
| A0A2G2KWQ2 | 29-125 | None |
| A0A1Q3WKP3 | 86-205 | None |
| A0A4Q8S4B3 | 7-124 | None |
| A0A661P5K2 | 99-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.