DPCstruct | MC37586
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 54 ± 6 aa |
| Standard deviation of domain lengths | 5.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 64.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8KAE2 | 1-42 | GELNPRHQHTVTLYARGLTCEADTLGSCGYVYLAVYPTPETK |
| D8A9H2 | 1-50 | MKQLELMLTSGELNPRNQHTVTLYAKGLACEADTLSSCGYVYLAVYPTPE |
| A0A4Y8F0Q0 | 2-61 | None |
| W1FB90 | 23-82 | None |
| A0A8B5EZT6 | 1-56 | None |
| W0A1M4 | 7-62 | None |
| A0A5E9YWH9 | 14-73 | None |
| A0A080I5Y9 | 2-52 | None |
| A0A7Z3YG04 | 64-126 | None |
| A0A827SP57 | 52-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.