DPCstruct | MC3758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 107 ± 10 aa |
| Standard deviation of domain lengths | 9.81 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B6HWV0 | 2-128 | ALIGHVFNRVLNKYIPVYIAESGNGFIRLTAYIDQKVKDAAFATVKAPFENGKLFKDDDMKQMEQLSITNMSHSSLGDTNAHYSVQG… |
| A0A2S6CE03 | 2-97 | YKASQLIKTMTTSKGKQIAVEYVTKTDSWERKMLASSVQTEFVAVAEKYKDNLKPETVKVAMKEAEHPSRADATQHYSAFELDKNNN… |
| A0A6A6Q468 | 2-111 | None |
| A0A420YAA5 | 3-102 | None |
| A0A1V6WUV0 | 52-174 | None |
| A0A6A6TVB0 | 1-118 | None |
| A0A094GNT0 | 4-121 | None |
| T5BT02 | 152-255 | None |
| A0A2V1D2Z8 | 2-106 | None |
| A0A4V5N4V1 | 3-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.