DPCstruct | MC37574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 169 ± 19 aa |
| Standard deviation of domain lengths | 19.17 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3B0J4 | 25-215 | DSIGERVDKLIWKNKPLSLGRMLSAQVSMQASFRGGNNDGKKNPQEQQLMDPNMYNNTGMPLDEYQQELAYISNNPGEFVDFSIPWD… |
| A0A3C1R8D3 | 10-165 | SSFNGGNNKSGGEDNLSIPKKRGVNLVDDFGNAMNDYEAETQYIRNNPGEFVDYNIPWDISFGYSLRYSNFLNANGSFSKSLSQDVN… |
| A0A1W9QXU0 | 8-166 | None |
| A0A090Q7H6 | 61-251 | None |
| A0A7J0AWV6 | 124-308 | None |
| A0A090X4B7 | 299-473 | None |
| A0A2V7KB14 | 149-329 | None |
| A0A6B1AL49 | 12-161 | None |
| A0A1V5J931 | 8-144 | None |
| A0A7Y2H8H9 | 3-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.