DPCstruct | MC37573
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 127 ± 18 aa |
| Standard deviation of domain lengths | 17.55 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 54.43 |
| Pfam Score | 85.00 |
| Assigned Pfam label(s) | CL0007- CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6I0J2 | 20-161 | TGVEIIIDDTPEAVVLSGFDPIRREVARIALEKLIADGRIHPARIEEMINKAEKEVDEEILRAAEEAIDEVGISQFPPELLKMLGKL… |
| A0A832LS40 | 117-256 | TGVDLIIDDTPEAVAISAFDPYRREVARIALERLLADGRIHPARIEEIVEKVRKEVDEEIVRAGEHAVMELGIHNMHPELVRHVGKM… |
| A0A7X1E7W7 | 176-317 | None |
| A0A835G3E7 | 243-384 | None |
| A0A061NW83 | 118-226 | None |
| A0A3D0UXB5 | 149-256 | None |
| A0A1L8ZF79 | 28-121 | None |
| A0A351Y7N0 | 1-142 | None |
| A0A4Y7X399 | 246-345 | None |
| X1S686 | 187-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.