DPCstruct | MC37570
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 147 ± 25 aa |
| Standard deviation of domain lengths | 24.74 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 14.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19736 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A536QIS1 | 156-291 | ADRQLEDLLARVRARHPSLRIDEVMPPFRSAHMPIQPGLRFAIALSVQGDELQLYVGDRFWVEYFPSSKPVVVEDLEARVLGLISGE… |
| A0A1G2Y103 | 7-149 | LYQSFVKQARKALSDHPQIKHEWSIDEDEDHCILDIPEMFDEGFAIKIEVNPDRITVIASGAHMTLNLNEYKNADELAAQALGLVRD… |
| A0A0A0BW36 | 5-125 | None |
| A0A1I1ZZ23 | 7-133 | None |
| A0A0Q5WGB5 | 106-238 | None |
| A0A430DAD3 | 12-161 | None |
| A0A0V8IPF9 | 160-344 | None |
| A0A1R4HW25 | 156-300 | None |
| A0A7C6J153 | 84-231 | None |
| A0A1Q3PU71 | 21-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.