DPCstruct | MC37569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 192 ± 27 aa |
| Standard deviation of domain lengths | 26.77 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.93 |
| Pfam Score | 82.58 |
| Assigned Pfam label(s) | PF09324- PF16206 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3BUG0 | 1-220 | MDFSWLVSSHPYNKLRESSVEVVCHLVQSVLNYRFMKQKNDENSTSSSESYYLMALQSLSQIKFIDIRQKQIECLLRILQSNGEDIT… |
| A0A183EI72 | 2-163 | LPLSSMSEIKYTDVRCKQISCLVNVLRSAGQQLTSDQWPTVIEIVRSVVGGKLNYDSVLVIQSYEAVALMIADFLEILPLDCIQLLV… |
| Q6GP04 | 824-1056 | None |
| A0A0D2MC55 | 197-355 | None |
| A0A061R7E5 | 159-358 | None |
| A0A7S3ZQP3 | 439-670 | None |
| A0A4Z2HQV3 | 108-312 | None |
| A0A6J0PET4 | 620-823 | None |
| A0A2G9SCF5 | 10-204 | None |
| A0A6V7X798 | 35-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.